PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G009784.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NAC
Protein Properties Length: 348aa    MW: 39049.9 Da    PI: 9.5414
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G009784.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.94.8e-54231501128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+d
  HL.SW.v1.0.G009784.1  23 LPPGFRFHPTDEELVVHYLKRKAAAAPLPV-TIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTD 110
                           79****************************.89***************988899*********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k++ls+ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  HL.SW.v1.0.G009784.1 111 KPILSSnGSQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 150
                           ****9967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6417188IPR003441NAC domain
PROSITE profilePS5100562.19523188IPR003441NAC domain
PfamPF023652.2E-2824150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MINMENSTDS SSSLRSSQHH PKLPPGFRFH PTDEELVVHY LKRKAAAAPL PVTIIAEIDL  60
YKFDPWELPS KASFGEQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD KPILSSNGSQ  120
KVGVKKALVF YGGKPPKGVK TNWIMHEYRL VDSTTSSNYP IPHHTPPTPN KKASLRLDDW  180
VLCRIYKKNN GQQSRPMMMM ERHDDHKEDS MDPMIIFPRP INNNYTALLE NEDCFLQGIL  240
EGNNNGNDPH QMGVKRQQPS SFWNEVAVGS SSMASPPQAK RFHGDLNSTT STTSATSSEI  300
NMNSSSFVSI LNQTASFHHQ NALLGSVNDG VLRSSIPQFR LPTMNWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-762319320173NAC domain-containing protein 19
3swp_C3e-762319320173NAC domain-containing protein 19
3swp_B3e-762319320173NAC domain-containing protein 19
3swp_A3e-762319320173NAC domain-containing protein 19
3swm_D3e-762319320173NAC domain-containing protein 19
3swm_C3e-762319320173NAC domain-containing protein 19
3swm_B3e-762319320173NAC domain-containing protein 19
3swm_A3e-762319320173NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293567.11e-144PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-103NAC25_ARATH; NAC transcription factor 25
TrEMBLW9RNN41e-140W9RNN4_9R
STRINGPOPTR_0011s04650.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-102NAC domain containing protein 25